SCOPe 2.06: Domain d5iuea1: 5iue A:2-181

Lineage for d5iuea1 (5iue A:2-181)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
   dimeric

4. Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families)

5. Family d.19.1.1: MHC antigen-recognition domain [54453] (13 proteins)

6. Protein automated matches [191280] (4 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [189896] (32 PDB entries)

8. Domain d5iuea1: 5iue A:2-181 [335377]
   Other proteins in same PDB: d5iuea2, d5iueb_, d5iuee2, d5iuef_, d5iueg2, d5iueh_, d5iuei2, d5iuej_
   automated match to d1efxa2
   complexed with nag

Details for d5iuea1

PDB Entry: 5iue, 2.62 Å

PDB Description: human leukocyte antigen f (hla-f) presents peptides and regulates immunity through interactions with nk-cell receptors

PDB Compounds: (A:) cDNA FLJ39643 fis, clone SMINT2004023, highly similar to HLA class I histocompatibility antigen, alphachain F

SCOPe Domain Sequences for d5iuea1:

Sequence; same for both SEQRES and ATOM records:

>d5iuea1 d.19.1.1 (A:2-181) automated matches {Human (Homo sapiens) [TaxId: 9606]}
shslryfstavsrpgrgepryiaveyvddtqflrfdsdaaiprmeprepwveqegpqywe
wttgyakanaqtdrvalrnllrrynqseagshtlqgmngcdmgpdgrllrgyhqhaydgk
dyislnedlrswtaadtvaqitqrfyeaeeyaeefrtylegeclellrrylengketlqr

Timeline for d5iuea1:

• d5iuea1 is new in SCOPe 2.06-stable
  
• d5iuea1 appears in SCOPe 2.07
  
• d5iuea1 appears in the current release, SCOPe 2.08