![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily) dimeric |
![]() | Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families) ![]() |
![]() | Family d.19.1.1: MHC antigen-recognition domain [54453] (13 proteins) |
![]() | Protein automated matches [191280] (6 species) not a true protein |
![]() | Species Human (Homo sapiens) [TaxId:9606] [189896] (35 PDB entries) |
![]() | Domain d5iuea1: 5iue A:2-181 [335377] Other proteins in same PDB: d5iuea2, d5iueb_, d5iuee2, d5iuef_, d5iueg2, d5iueh_, d5iuei2, d5iuej_ automated match to d1efxa2 complexed with nag |
PDB Entry: 5iue (more details), 2.62 Å
SCOPe Domain Sequences for d5iuea1:
Sequence; same for both SEQRES and ATOM records: (download)
>d5iuea1 d.19.1.1 (A:2-181) automated matches {Human (Homo sapiens) [TaxId: 9606]} shslryfstavsrpgrgepryiaveyvddtqflrfdsdaaiprmeprepwveqegpqywe wttgyakanaqtdrvalrnllrrynqseagshtlqgmngcdmgpdgrllrgyhqhaydgk dyislnedlrswtaadtvaqitqrfyeaeeyaeefrtylegeclellrrylengketlqr
Timeline for d5iuea1: