Class b: All beta proteins [48724] (180 folds) |
Fold b.81: Single-stranded left-handed beta-helix [51160] (4 superfamilies) superhelix turns are made of parallel beta-strands and (short) turns |
Superfamily b.81.1: Trimeric LpxA-like enzymes [51161] (9 families) superhelical turns are made of three short strands; duplication: the sequence hexapeptide repeats correspond to individual strands |
Family b.81.1.0: automated matches [191560] (1 protein) not a true family |
Protein automated matches [190967] (36 species) not a true protein |
Species Moraxella catarrhalis [TaxId:1236608] [335370] (1 PDB entry) |
Domain d5jxxc_: 5jxx C: [335372] automated match to d4e6ua_ complexed with flc, gol |
PDB Entry: 5jxx (more details), 3 Å
SCOPe Domain Sequences for d5jxxc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5jxxc_ b.81.1.0 (C:) automated matches {Moraxella catarrhalis [TaxId: 1236608]} mtihptaiidksamiadsaiigpycivgknsqigahtvlrshviigentkigvhndiyqf asigenpqdlkyageqtyleigdhnrireactihrgtvqdrgitrignqnllmvnvhiah dcvvgddnvlannvgvaghahignhviiggqsgvhqfcriddysmvggaslivkdvaayv masgnpakahglnkegmrrkgwskdtikaldeayrlvfrsgllrdealdeltklvekepk iqllidsinnskrglvr
Timeline for d5jxxc_: