Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies) 3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest |
Superfamily c.55.1: Actin-like ATPase domain [53067] (16 families) duplication contains two domains of this fold |
Family c.55.1.4: Glycerol kinase [53089] (1 protein) |
Protein Glycerol kinase [53090] (2 species) |
Species Escherichia coli [TaxId:562] [53091] (14 PDB entries) |
Domain d1boto1: 1bot O:3-253 [33537] complexed with epe, gol |
PDB Entry: 1bot (more details), 3.05 Å
SCOPe Domain Sequences for d1boto1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1boto1 c.55.1.4 (O:3-253) Glycerol kinase {Escherichia coli [TaxId: 562]} kkyivaldqgttssravvmdhdaniisvsqrefeqiypkpgwvehdpmeiwatqsstlve vlakadissdqiaaigitnqrettivweketgkpiynaivwqcrrtaeicehlkrdgled yirsntglvidpyfsgtkvkwildhvegsrerarrgellfgtvdtwliwkmtqgrvhvtd ytnasrtmlfnihtldwddkmlevldipremlpevrrssevygqtniggkggtripisgi agdqqaalfgq
Timeline for d1boto1: