SCOPe 2.05: Domain d1boto1: 1bot O:3-253

Lineage for d1boto1 (1bot O:3-253)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
   3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest

4. Superfamily c.55.1: Actin-like ATPase domain [53067] (16 families)
   duplication contains two domains of this fold

5. Family c.55.1.4: Glycerol kinase [53089] (1 protein)

6. Protein Glycerol kinase [53090] (2 species)

7. Species Escherichia coli [TaxId:562] [53091] (13 PDB entries)

8. Domain d1boto1: 1bot O:3-253 [33537]
   complexed with epe, gol

Details for d1boto1

PDB Entry: 1bot, 3.05 Å

PDB Description: crystal structure of the complex between escherichia coli glycerol kinase and the allosteric regulator fructose 1,6-bisphosphate.

PDB Compounds: (O:) protein (glycerol kinase)

SCOPe Domain Sequences for d1boto1:

Sequence; same for both SEQRES and ATOM records:

>d1boto1 c.55.1.4 (O:3-253) Glycerol kinase {Escherichia coli [TaxId: 562]}
kkyivaldqgttssravvmdhdaniisvsqrefeqiypkpgwvehdpmeiwatqsstlve
vlakadissdqiaaigitnqrettivweketgkpiynaivwqcrrtaeicehlkrdgled
yirsntglvidpyfsgtkvkwildhvegsrerarrgellfgtvdtwliwkmtqgrvhvtd
ytnasrtmlfnihtldwddkmlevldipremlpevrrssevygqtniggkggtripisgi
agdqqaalfgq

Timeline for d1boto1:

• d1boto1 first appeared (with stable ids) in SCOP 1.55
  
• d1boto1 appears in SCOPe 2.04
  
• d1boto1 appears in SCOPe 2.06
  
• d1boto1 appears in the current release, SCOPe 2.08