Lineage for d1glly2 (1gll Y:254-499)

  1. Root: SCOPe 2.03
  2. 1336837Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1372364Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest
  4. 1372365Superfamily c.55.1: Actin-like ATPase domain [53067] (15 families) (S)
    duplication contains two domains of this fold
  5. 1372952Family c.55.1.4: Glycerol kinase [53089] (1 protein)
  6. 1372953Protein Glycerol kinase [53090] (2 species)
  7. 1372995Species Escherichia coli [TaxId:562] [53091] (13 PDB entries)
  8. 1373049Domain d1glly2: 1gll Y:254-499 [33536]
    complexed with acp, gol, mg; mutant

Details for d1glly2

PDB Entry: 1gll (more details), 3 Å

PDB Description: escherichia coli glycerol kinase mutant with bound atp analog showing substantial domain motion
PDB Compounds: (Y:) glycerol kinase

SCOPe Domain Sequences for d1glly2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1glly2 c.55.1.4 (Y:254-499) Glycerol kinase {Escherichia coli [TaxId: 562]}
lcvkegmakntygtgcfmlmntgekavksengllttiacgptgevnyalegavfmagasi
qwlrdemklindaydseyfatkvqntngvyvvpaftglgapywdpyargaifgltrgvna
nhiiratlesiayqtrdvleamqadsgirlhalrvdggavannflmqfqsdilgtrverp
evrevtalgaaylaglavgfwqnldelqekavierefrpgietternyryagwkkavkra
maweeh

SCOPe Domain Coordinates for d1glly2:

Click to download the PDB-style file with coordinates for d1glly2.
(The format of our PDB-style files is described here.)

Timeline for d1glly2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1glly1