Class d: Alpha and beta proteins (a+b) [53931] (385 folds) |
Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies) core: beta(2)-alpha-beta(2); mixed beta-sheet 2143 |
Superfamily d.15.1: Ubiquitin-like [54236] (11 families) |
Family d.15.1.1: Ubiquitin-related [54237] (39 proteins) Pfam PF00240 |
Protein Ubiquitin [54238] (8 species) |
Species Saccharomyces cerevisiae [TaxId:559292] [335358] (1 PDB entry) |
Domain d5l6jb_: 5l6j B: [335359] automated match to d1otrb_ complexed with 61t, cl, gol, so4 |
PDB Entry: 5l6j (more details), 2.68 Å
SCOPe Domain Sequences for d5l6jb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5l6jb_ d.15.1.1 (B:) Ubiquitin {Saccharomyces cerevisiae [TaxId: 559292]} mqifvktltgktitlevessdtidnvkskiqdkegippdqqrlifagkqledgrtlsdyn iqkestlhlvlrlrgg
Timeline for d5l6jb_: