Lineage for d5l6jb_ (5l6j B:)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2177211Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 2177212Superfamily d.15.1: Ubiquitin-like [54236] (11 families) (S)
  5. 2177213Family d.15.1.1: Ubiquitin-related [54237] (39 proteins)
    Pfam PF00240
  6. 2177487Protein Ubiquitin [54238] (8 species)
  7. 2178050Species Saccharomyces cerevisiae [TaxId:559292] [335358] (1 PDB entry)
  8. 2178051Domain d5l6jb_: 5l6j B: [335359]
    automated match to d1otrb_
    complexed with 61t, cl, gol, so4

Details for d5l6jb_

PDB Entry: 5l6j (more details), 2.68 Å

PDB Description: uba1 in complex with ub-mln7243 covalent adduct
PDB Compounds: (B:) Ubiquitin-40S ribosomal protein S31

SCOPe Domain Sequences for d5l6jb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5l6jb_ d.15.1.1 (B:) Ubiquitin {Saccharomyces cerevisiae [TaxId: 559292]}
mqifvktltgktitlevessdtidnvkskiqdkegippdqqrlifagkqledgrtlsdyn
iqkestlhlvlrlrgg

SCOPe Domain Coordinates for d5l6jb_:

Click to download the PDB-style file with coordinates for d5l6jb_.
(The format of our PDB-style files is described here.)

Timeline for d5l6jb_: