Lineage for d5iiag_ (5iia G:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2697878Fold a.19: Fertilization protein [47081] (1 superfamily)
    core: 3 helices; bundle, closed, right-handed twist; up-and-down
  4. 2697879Superfamily a.19.1: Fertilization protein [47082] (1 family) (S)
    automatically mapped to Pfam PF01303
  5. 2697880Family a.19.1.1: Fertilization protein [47083] (3 proteins)
  6. 2697881Protein Lysin [47084] (2 species)
  7. 2697885Species Red abalone (Haliotis rufescens) [TaxId:6454] [47085] (6 PDB entries)
  8. 2697891Domain d5iiag_: 5iia G: [335354]
    automated match to d2lisa_
    complexed with nag

Details for d5iiag_

PDB Entry: 5iia (more details), 1.7 Å

PDB Description: crystal structure of red abalone egg verl repeat 3 in complex with sperm lysin at 1.7 a resolution (crystal form i)
PDB Compounds: (G:) Egg-lysin

SCOPe Domain Sequences for d5iiag_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5iiag_ a.19.1.1 (G:) Lysin {Red abalone (Haliotis rufescens) [TaxId: 6454]}
kflnkafevalkvqiiagfdrglvkwlrvhgrtlstvqkkalyfvnrrymqthwanymlw
inkkidalgrtpvvgdytrlgaeigrridmayfydflkdknmipkylpymeeinrmrpad
vpvkym

SCOPe Domain Coordinates for d5iiag_:

Click to download the PDB-style file with coordinates for d5iiag_.
(The format of our PDB-style files is described here.)

Timeline for d5iiag_: