![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.19: Fertilization protein [47081] (1 superfamily) core: 3 helices; bundle, closed, right-handed twist; up-and-down |
![]() | Superfamily a.19.1: Fertilization protein [47082] (1 family) ![]() automatically mapped to Pfam PF01303 |
![]() | Family a.19.1.1: Fertilization protein [47083] (3 proteins) |
![]() | Protein automated matches [335347] (1 species) not a true protein |
![]() | Species Red abalone (Haliotis rufescens) [TaxId:6454] [335348] (5 PDB entries) |
![]() | Domain d5ii9b_: 5ii9 B: [335352] automated match to d2lisa_ |
PDB Entry: 5ii9 (more details), 2.11 Å
SCOPe Domain Sequences for d5ii9b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5ii9b_ a.19.1.1 (B:) automated matches {Red abalone (Haliotis rufescens) [TaxId: 6454]} hyvepkflnkafevalkvqiiagfdrglvkwlrvhgrtlstvqkkalyfvnrrymqthwa nymlwinkkidalgrtpvvgdytrlgaeigrridmayfydflkdknmipkylpymeeinr mrpadvpvkym
Timeline for d5ii9b_: