Lineage for d5ii9a_ (5ii9 A:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2697878Fold a.19: Fertilization protein [47081] (1 superfamily)
    core: 3 helices; bundle, closed, right-handed twist; up-and-down
  4. 2697879Superfamily a.19.1: Fertilization protein [47082] (1 family) (S)
    automatically mapped to Pfam PF01303
  5. 2697880Family a.19.1.1: Fertilization protein [47083] (3 proteins)
  6. 2697902Protein automated matches [335347] (1 species)
    not a true protein
  7. 2697903Species Red abalone (Haliotis rufescens) [TaxId:6454] [335348] (5 PDB entries)
  8. 2697910Domain d5ii9a_: 5ii9 A: [335349]
    automated match to d2lisa_

Details for d5ii9a_

PDB Entry: 5ii9 (more details), 2.11 Å

PDB Description: monoclinic crystal structure of red abalone lysin at 2.11 a resolution
PDB Compounds: (A:) Egg-lysin

SCOPe Domain Sequences for d5ii9a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5ii9a_ a.19.1.1 (A:) automated matches {Red abalone (Haliotis rufescens) [TaxId: 6454]}
hyvepkflnkafevalkvqiiagfdrglvkwlrvhgrtlstvqkkalyfvnrrymqthwa
nymlwinkkidalgrtpvvgdytrlgaeigrridmayfydflkdknmipkylpymeeinr
mrpadvpvkym

SCOPe Domain Coordinates for d5ii9a_:

Click to download the PDB-style file with coordinates for d5ii9a_.
(The format of our PDB-style files is described here.)

Timeline for d5ii9a_: