SCOPe 2.07: Domain d5h0vd1: 5h0v D:11-125

Lineage for d5h0vd1 (5h0v D:11-125)

Root: SCOPe 2.07
Class b: All beta proteins [48724] (178 folds)
Fold b.3: Prealbumin-like [49451] (8 superfamilies)
sandwich; 7 strands in 2 sheets, greek-key
variations: some members have additional 1-2 strands to common fold
Superfamily b.3.4: Transthyretin (synonym: prealbumin) [49472] (2 families)
Family b.3.4.1: Transthyretin (synonym: prealbumin) [49473] (2 proteins)
automatically mapped to Pfam PF00576
Protein Transthyretin (synonym: prealbumin) [49474] (5 species)
sandwich; 8 strands in 2 sheets
Species Human (Homo sapiens) [TaxId:9606] [49475] (320 PDB entries)
Uniprot P02766 31-143
Domain d5h0vd1: 5h0v D:11-125 [335344]
Other proteins in same PDB: d5h0va2, d5h0vb2, d5h0vc2, d5h0vd2
automated match to d5ezpe_
complexed with mg, mpd

Details for d5h0vd1

PDB Entry: 5h0v (more details), 1.58 Å

PDB Description: crystal structure of h88a mutated human transthyretin

PDB Compounds: (D:) Transthyretin

SCOPe Domain Sequences for d5h0vd1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5h0vd1 b.3.4.1 (D:11-125) Transthyretin (synonym: prealbumin) {Human (Homo sapiens) [TaxId: 9606]}
plmvkvldavrgspainvavhvfrkaaddtwepfasgktsesgelhgltteeefvegiyk
veidtksywkalgispfaehaevvftandsgprrytiaallspysysttavvtnp

SCOPe Domain Coordinates for d5h0vd1:

Click to download the PDB-style file with coordinates for d5h0vd1.
(The format of our PDB-style files is described here.)

Timeline for d5h0vd1: