SCOP 1.57: Domain d1gllo2: 1gll O:254-499

Lineage for d1gllo2 (1gll O:254-499)

1. Root: SCOP 1.57

2. Class c: Alpha and beta proteins (a/b) [51349] (107 folds)

3. Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)

4. Superfamily c.55.1: Actin-like ATPase domain [53067] (5 families)

5. Family c.55.1.4: Glycerol kinase [53089] (1 protein)

6. Protein Glycerol kinase [53090] (1 species)

7. Species Escherichia coli [TaxId:562] [53091] (12 PDB entries)

8. Domain d1gllo2: 1gll O:254-499 [33534]

Details for d1gllo2

PDB Entry: 1gll, 3 Å

PDB Description: escherichia coli glycerol kinase mutant with bound atp analog showing substantial domain motion

SCOP Domain Sequences for d1gllo2:

Sequence; same for both SEQRES and ATOM records:

>d1gllo2 c.55.1.4 (O:254-499) Glycerol kinase {Escherichia coli}
lcvkegmakntygtgcfmlmntgekavksengllttiacgptgevnyalegavfmagasi
qwlrdemklindaydseyfatkvqntngvyvvpaftglgapywdpyargaifgltrgvna
nhiiratlesiayqtrdvleamqadsgirlhalrvdggavannflmqfqsdilgtrverp
evrevtalgaaylaglavgfwqnldelqekavierefrpgietternyryagwkkavkra
maweeh

Timeline for d1gllo2:

• d1gllo2 first appeared (with stable ids) in SCOP 1.55
  
• d1gllo2 appears in SCOP 1.59
  
• d1gllo2 appears in the current release, SCOPe 2.08