| Class d: Alpha and beta proteins (a+b) [53931] (385 folds) |
| Fold d.22: GFP-like [54510] (1 superfamily) beta-sheet folds into a barrel (n=11, S=14) around the central helix |
Superfamily d.22.1: GFP-like [54511] (3 families) ![]() |
| Family d.22.1.1: Fluorescent proteins [54512] (6 proteins) |
| Protein automated matches [190406] (19 species) not a true protein |
| Species Jellyfish (Aequorea victoria) [TaxId:6100] [188134] (54 PDB entries) |
| Domain d5b61d_: 5b61 D: [335336] automated match to d3st2a_ |
PDB Entry: 5b61 (more details), 3.12 Å
SCOPe Domain Sequences for d5b61d_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5b61d_ d.22.1.1 (D:) automated matches {Jellyfish (Aequorea victoria) [TaxId: 6100]}
geelftgvvpilveldgdvnghkfsvrgegegdatngkitlklicttgklpvpwptlvtt
cgygvqcfarypdhmkrhdffksampegyvqertisfkddgtfktraevkfegdtivnri
klkgidfkedgnilghkleynfnshkvyitadkqkngikanfkirhnvedgsvqladhyq
qntpigdgpvrlpdnhylstqsviledpnekrdhmvlhefvtaagit
Timeline for d5b61d_: