Lineage for d5b87a_ (5b87 A:)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2502820Fold c.67: PLP-dependent transferase-like [53382] (3 superfamilies)
    main domain: 3 layers: a/b/a, mixed beta-sheet of 7 strands, order 3245671; strand 7 is antiparallel to the rest
  4. 2502821Superfamily c.67.1: PLP-dependent transferases [53383] (10 families) (S)
  5. 2504326Family c.67.1.0: automated matches [191328] (1 protein)
    not a true family
  6. 2504327Protein automated matches [190151] (160 species)
    not a true protein
  7. 2505687Species Thermococcus onnurineus [TaxId:523850] [335326] (4 PDB entries)
  8. 2505692Domain d5b87a_: 5b87 A: [335329]
    Other proteins in same PDB: d5b87b2
    automated match to d1jf9a_
    complexed with ala, plp

Details for d5b87a_

PDB Entry: 5b87 (more details), 2.28 Å

PDB Description: crystal structure of a cysteine desulfurase from thermococcus onnurineus na1 in complex with alanine at 2.3 angstrom resolution
PDB Compounds: (A:) Cysteine desulfurase

SCOPe Domain Sequences for d5b87a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5b87a_ c.67.1.0 (A:) automated matches {Thermococcus onnurineus [TaxId: 523850]}
ripedvrkdipltneviyfdntatsltpkpvveamdeyylkyranvhrgvhrlsqmathk
yeesrkivadfigakfeeivftkntseslnlvalglghifkrgdkivttpyehhsdllpw
qrlatklglklefiegddegnldlsdaekkikgaklvavqhvsnalgviheveelgkiak
degaifvvdaaqsaghmevnvkklhadflafsghkgpmgptgigvlyireeffdtfeppl
igggtiedvsldgykltepperfeagtpniggaiglaagiryieriglgrierqehklvk
rttegldelevpwygprnlkkhagvvsfnvpglhphdvaailddhsimvrsghhcalpvm
kklgingtvrasfhvynsleevetflgvmeelvkglk

SCOPe Domain Coordinates for d5b87a_:

Click to download the PDB-style file with coordinates for d5b87a_.
(The format of our PDB-style files is described here.)

Timeline for d5b87a_: