SCOPe 2.06: Domain d5b61b_: 5b61 B:

Lineage for d5b61b_ (5b61 B:)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.22: GFP-like [54510] (1 superfamily)
   beta-sheet folds into a barrel (n=11, S=14) around the central helix

4. Superfamily d.22.1: GFP-like [54511] (3 families)

5. Family d.22.1.1: Fluorescent proteins [54512] (6 proteins)

6. Protein automated matches [190406] (19 species)
   not a true protein

7. Species Jellyfish (Aequorea victoria) [TaxId:6100] [188134] (54 PDB entries)

8. Domain d5b61b_: 5b61 B: [335324]
   automated match to d3st2a_

Details for d5b61b_

PDB Entry: 5b61, 3.12 Å

PDB Description: extra-superfolder gfp

PDB Compounds: (B:) Green fluorescent protein

SCOPe Domain Sequences for d5b61b_:

Sequence; same for both SEQRES and ATOM records:

>d5b61b_ d.22.1.1 (B:) automated matches {Jellyfish (Aequorea victoria) [TaxId: 6100]}
lftgvvpilveldgdvnghkfsvrgegegdatngkitlklicttgklpvpwptlvttcgy
gvqcfarypdhmkrhdffksampegyvqertisfkddgtfktraevkfegdtivnriklk
gidfkedgnilghkleynfnshkvyitadkqkngikanfkirhnvedgsvqladhyqqnt
pigdgpvrlpdnhylstqsviledpnekrdhmvlhefvtaagit

Timeline for d5b61b_:

• d5b61b_ is new in SCOPe 2.06-stable
  
• d5b61b_ appears in SCOPe 2.07
  
• d5b61b_ appears in the current release, SCOPe 2.08