SCOPe 2.08: Domain d5nm0a1: 5nm0 A:3-118

Lineage for d5nm0a1 (5nm0 A:3-118)

Root: SCOPe 2.08
Class b: All beta proteins [48724] (180 folds)
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
sandwich; 7 strands in 2 sheets; greek-key
some members of the fold have additional strands
Superfamily b.1.1: Immunoglobulin [48726] (5 families)
Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
Protein automated matches [190119] (24 species)
not a true protein
Species Llama (Lama glama) [TaxId:9844] [187485] (245 PDB entries)
Domain d5nm0a1: 5nm0 A:3-118 [335318]
Other proteins in same PDB: d5nm0a2, d5nm0b2, d5nm0c2, d5nm0d2
automated match to d3ogog_
complexed with hg

Details for d5nm0a1

PDB Entry: 5nm0 (more details), 1.5 Å

PDB Description: nb36 ser85cys with hg, crystal form 1

PDB Compounds: (A:) Nb36

SCOPe Domain Sequences for d5nm0a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5nm0a1 b.1.1.1 (A:3-118) automated matches {Llama (Lama glama) [TaxId: 9844]}
vqlvesggglvqaggslrlscvvsgsavsdyamgwyrqapgkqrelvaaiynsgrtnyvd
svkgrftiskdnakktvylqmnclkpedtadyfcnllgattmsnavwgqgtqvtvs

SCOPe Domain Coordinates for d5nm0a1:

Click to download the PDB-style file with coordinates for d5nm0a1.
(The format of our PDB-style files is described here.)

Timeline for d5nm0a1: