Lineage for d5nm0d1 (5nm0 D:3-117)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2352459Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2352460Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2352461Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 2355068Protein automated matches [190119] (22 species)
    not a true protein
  7. 2355831Species Llama (Lama glama) [TaxId:9844] [187485] (223 PDB entries)
  8. 2355885Domain d5nm0d1: 5nm0 D:3-117 [335317]
    Other proteins in same PDB: d5nm0a2, d5nm0b2, d5nm0c2, d5nm0d2
    automated match to d3ogog_
    complexed with hg

Details for d5nm0d1

PDB Entry: 5nm0 (more details), 1.5 Å

PDB Description: nb36 ser85cys with hg, crystal form 1
PDB Compounds: (D:) Nb36

SCOPe Domain Sequences for d5nm0d1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5nm0d1 b.1.1.1 (D:3-117) automated matches {Llama (Lama glama) [TaxId: 9844]}
vqlvesggglvqaggslrlscvvsgsavsdyamgwyrqapgkqrelvaaiynsgrtnyvd
svkgrftiskdnakktvylqmnclkpedtadyfcnllgattmsnavwgqgtqvtv

SCOPe Domain Coordinates for d5nm0d1:

Click to download the PDB-style file with coordinates for d5nm0d1.
(The format of our PDB-style files is described here.)

Timeline for d5nm0d1: