SCOPe 2.08: Domain d5viqa1: 5viq A:19-126

Lineage for d5viqa1 (5viq A:19-126)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.110: Profilin-like [55769] (10 superfamilies)
   core: 2 alpha-helices and 5-stranded antiparallel sheet: order 21543; 3 layers: alpha/beta/alpha

4. Superfamily d.110.3: PYP-like sensor domain (PAS domain) [55785] (8 families)
   alpha-beta(2)-alpha(2)-beta(3)

5. Family d.110.3.0: automated matches [191387] (1 protein)
   not a true family

6. Protein automated matches [190492] (24 species)
   not a true protein

7. Species Rhodopseudomonas palustris [TaxId:1076] [335300] (2 PDB entries)

8. Domain d5viqa1: 5viq A:19-126 [335301]
   Other proteins in same PDB: d5viqa2
   automated match to d2oolb2
   complexed with bla

Details for d5viqa1

PDB Entry: 5viq, 1.34 Å

PDB Description: crystal structure of monomeric near-infrared fluorescent protein mirfp709

PDB Compounds: (A:) monomeric near-infrared fluorescent protein miRFP709

SCOPe Domain Sequences for d5viqa1:

Sequence; same for both SEQRES and ATOM records:

>d5viqa1 d.110.3.0 (A:19-126) automated matches {Rhodopseudomonas palustris [TaxId: 1076]}
nceheeihlagsiqphgallvvsehdhrviqasanaaeflnlgsvlgvplaeidgdllik
ilphldptaegmpvavrcrignpsteycglmhrppeggliieleragp

Timeline for d5viqa1:

• d5viqa1 first appeared in SCOPe 2.06
  
• d5viqa1 appears in SCOPe 2.07