SCOPe 2.03: Domain d1bwfo2: 1bwf O:254-499

Lineage for d1bwfo2 (1bwf O:254-499)

1. Root: SCOPe 2.03

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
   3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest

4. Superfamily c.55.1: Actin-like ATPase domain [53067] (15 families)
   duplication contains two domains of this fold

5. Family c.55.1.4: Glycerol kinase [53089] (1 protein)

6. Protein Glycerol kinase [53090] (2 species)

7. Species Escherichia coli [TaxId:562] [53091] (13 PDB entries)

8. Domain d1bwfo2: 1bwf O:254-499 [33530]
   complexed with atf, gol, mg; mutant

Details for d1bwfo2

PDB Entry: 1bwf, 3 Å

PDB Description: escherichia coli glycerol kinase mutant with bound atp analog showing substantial domain motion

PDB Compounds: (O:) glycerol kinase

SCOPe Domain Sequences for d1bwfo2:

Sequence; same for both SEQRES and ATOM records:

>d1bwfo2 c.55.1.4 (O:254-499) Glycerol kinase {Escherichia coli [TaxId: 562]}
lcvkegmakntygtgcfmlmntgekavksengllttiacgptgevnyalegavfmagasi
qwlrdemklindaydseyfatkvqntngvyvvpaftglgapywdpyargaifgltrgvna
nhiiratlesiayqtrdvleamqadsgirlhalrvdggavannflmqfqsdilgtrverp
evrevtalgaaylaglavgfwqnldelqekavierefrpgietternyryagwkkavkra
maweeh

Timeline for d1bwfo2:

• d1bwfo2 first appeared (with stable ids) in SCOP 1.55
  
• d1bwfo2 appears in SCOPe 2.02
  
• d1bwfo2 appears in SCOPe 2.04
  
• d1bwfo2 appears in the current release, SCOPe 2.08