| Class a: All alpha proteins [46456] (289 folds) |
| Fold a.123: Nuclear receptor ligand-binding domain [48507] (1 superfamily) multihelical; 3 layers or orthogonally packed helices |
Superfamily a.123.1: Nuclear receptor ligand-binding domain [48508] (2 families) ![]() |
| Family a.123.1.0: automated matches [191623] (1 protein) not a true family |
| Protein automated matches [191142] (6 species) not a true protein |
| Species Nomascus leucogenys [TaxId:61853] [335245] (4 PDB entries) |
| Domain d5x8xc_: 5x8x C: [335283] automated match to d3l0la_ complexed with 82o; mutant |
PDB Entry: 5x8x (more details), 2.6 Å
SCOPe Domain Sequences for d5x8xc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5x8xc_ a.123.1.0 (C:) automated matches {Nomascus leucogenys [TaxId: 61853]}
slteiehlvqsvcksyretcqlrledllrqrsnifsreevtgyqrksmwemwercahhlt
eaiqyvvefakrlsgfmelcqndqivllkagamevvlvrmcraynadnrtvffegkyggm
elfralgcselissifdfshslsalhfsedeialytalvlinahrpglqekrkveqlqyn
lelafhhhlckthrqsilaklppagklaslcsqhverlqifqhlhpiv
Timeline for d5x8xc_: