Lineage for d5x8xc_ (5x8x C:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2728284Fold a.123: Nuclear receptor ligand-binding domain [48507] (1 superfamily)
    multihelical; 3 layers or orthogonally packed helices
  4. 2728285Superfamily a.123.1: Nuclear receptor ligand-binding domain [48508] (2 families) (S)
  5. 2729960Family a.123.1.0: automated matches [191623] (1 protein)
    not a true family
  6. 2729961Protein automated matches [191142] (5 species)
    not a true protein
  7. 2729974Species Human (Homo sapiens) [TaxId:9606] [189274] (121 PDB entries)
  8. 2730130Domain d5x8xc_: 5x8x C: [335283]
    automated match to d3l0la_
    complexed with 82o; mutant

Details for d5x8xc_

PDB Entry: 5x8x (more details), 2.6 Å

PDB Description: crystal structure of the mutant human ror gamma ligand binding domain with compound a.
PDB Compounds: (C:) Nuclear receptor ROR-gamma

SCOPe Domain Sequences for d5x8xc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5x8xc_ a.123.1.0 (C:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
slteiehlvqsvcksyretcqlrledllrqrsnifsreevtgyqrksmwemwercahhlt
eaiqyvvefakrlsgfmelcqndqivllkagamevvlvrmcraynadnrtvffegkyggm
elfralgcselissifdfshslsalhfsedeialytalvlinahrpglqekrkveqlqyn
lelafhhhlckthrqsilaklppagklaslcsqhverlqifqhlhpiv

SCOPe Domain Coordinates for d5x8xc_:

Click to download the PDB-style file with coordinates for d5x8xc_.
(The format of our PDB-style files is described here.)

Timeline for d5x8xc_: