SCOP 1.71: Domain d1gljy2: 1glj Y:254-499

Lineage for d1gljy2 (1glj Y:254-499)

1. Root: SCOP 1.71

2. Class c: Alpha and beta proteins (a/b) [51349] (134 folds)

3. Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
   3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest

4. Superfamily c.55.1: Actin-like ATPase domain [53067] (11 families)
   duplication contains two domains of this fold

5. Family c.55.1.4: Glycerol kinase [53089] (1 protein)

6. Protein Glycerol kinase [53090] (2 species)

7. Species Escherichia coli [TaxId:562] [53091] (12 PDB entries)

8. Domain d1gljy2: 1glj Y:254-499 [33528]
   complexed with ata, gol, mg; mutant

Details for d1gljy2

PDB Entry: 1glj, 3 Å

PDB Description: escherichia coli glycerol kinase mutant with bound atp analog showing substantial domain motion

SCOP Domain Sequences for d1gljy2:

Sequence; same for both SEQRES and ATOM records:

>d1gljy2 c.55.1.4 (Y:254-499) Glycerol kinase {Escherichia coli}
lcvkegmakntygtgcfmlmntgekavksengllttiacgptgevnyalegavfmagasi
qwlrdemklindaydseyfatkvqntngvyvvpaftglgapywdpyargaifgltrgvna
nhiiratlesiayqtrdvleamqadsgirlhalrvdggavannflmqfqsdilgtrverp
evrevtalgaaylaglavgfwqnldelqekavierefrpgietternyryagwkkavkra
maweeh

Timeline for d1gljy2:

• d1gljy2 first appeared (with stable ids) in SCOP 1.55
  
• d1gljy2 appears in SCOP 1.69
  
• d1gljy2 appears in SCOP 1.73
  
• d1gljy2 appears in the current release, SCOPe 2.08