SCOPe 2.07: Domain d3wmmd_: 3wmm D:

Lineage for d3wmmd_ (3wmm D:)

1. Root: SCOPe 2.07

2. Class f: Membrane and cell surface proteins and peptides [56835] (60 folds)

3. Fold f.3: Light-harvesting complex subunits [56917] (1 superfamily)
   membrane all-alpha fold

4. Superfamily f.3.1: Light-harvesting complex subunits [56918] (2 families)

5. Family f.3.1.0: automated matches [254203] (1 protein)
   not a true family

6. Protein automated matches [254444] (7 species)
   not a true protein

7. Species Thermochromatium tepidum [TaxId:1050] [267909] (5 PDB entries)

8. Domain d3wmmd_: 3wmm D: [335272]
   Other proteins in same PDB: d3wmmc_, d3wmmh1, d3wmmh2, d3wmmm_
   automated match to d3wmn5_
   complexed with bcl, bph, ca, crt, fe, hem, mq8, pef, pgw, po4, uq8

Details for d3wmmd_

PDB Entry: 3wmm, 3.01 Å

PDB Description: crystal structure of the lh1-rc complex from thermochromatium tepidum in c2 form

PDB Compounds: (D:) LH1 alpha polypeptide

SCOPe Domain Sequences for d3wmmd_:

Sequence; same for both SEQRES and ATOM records:

>d3wmmd_ f.3.1.0 (D:) automated matches {Thermochromatium tepidum [TaxId: 1050]}
ftmnanlykiwlildprrvlvsivafqivlgllihmivlstdlnwlddnipvsyqalgkk

Timeline for d3wmmd_:

• d3wmmd_ first appeared in SCOPe 2.06
  
• d3wmmd_ appears in the current release, SCOPe 2.08