SCOPe 2.08: Domain d5vaab2: 5vaa B:342-442

Lineage for d5vaab2 (5vaa B:342-442)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (31 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [188198] (836 PDB entries)

8. Domain d5vaab2: 5vaa B:342-442 [335266]
   automated match to d1igyb4
   complexed with gol, mes; mutant

Details for d5vaab2

PDB Entry: 5vaa, 1.55 Å

PDB Description: crystal structure of mouse igg2a fc t370k mutant

PDB Compounds: (B:) ig gamma-2a chain c region, a allele

SCOPe Domain Sequences for d5vaab2:

Sequence; same for both SEQRES and ATOM records:

>d5vaab2 b.1.1.0 (B:342-442) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
svrapqvyvlpppeeemtkkqvtltcmvkdfmpediyvewtnngktelnykntepvldsd
gsyfmysklrvekknwvernsyscsvvheglhnhhttksfs

Timeline for d5vaab2:

• d5vaab2 first appeared in SCOPe 2.06
  
• d5vaab2 appears in SCOPe 2.07