| Class b: All beta proteins [48724] (180 folds) |
| Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) ![]() |
| Family b.1.1.0: automated matches [191470] (1 protein) not a true family |
| Protein automated matches [190740] (31 species) not a true protein |
| Species Mouse (Mus musculus) [TaxId:10090] [188198] (836 PDB entries) |
| Domain d5vaab2: 5vaa B:342-442 [335266] automated match to d1igyb4 complexed with gol, mes; mutant |
PDB Entry: 5vaa (more details), 1.55 Å
SCOPe Domain Sequences for d5vaab2:
Sequence; same for both SEQRES and ATOM records: (download)
>d5vaab2 b.1.1.0 (B:342-442) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
svrapqvyvlpppeeemtkkqvtltcmvkdfmpediyvewtnngktelnykntepvldsd
gsyfmysklrvekknwvernsyscsvvheglhnhhttksfs
Timeline for d5vaab2: