Class a: All alpha proteins [46456] (289 folds) |
Fold a.123: Nuclear receptor ligand-binding domain [48507] (1 superfamily) multihelical; 3 layers or orthogonally packed helices |
Superfamily a.123.1: Nuclear receptor ligand-binding domain [48508] (2 families) |
Family a.123.1.0: automated matches [191623] (1 protein) not a true family |
Protein automated matches [191142] (6 species) not a true protein |
Species Nomascus leucogenys [TaxId:61853] [335245] (17 PDB entries) |
Domain d5x8xg_: 5x8x G: [335259] automated match to d3l0la_ complexed with 82o; mutant |
PDB Entry: 5x8x (more details), 2.6 Å
SCOPe Domain Sequences for d5x8xg_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5x8xg_ a.123.1.0 (G:) automated matches {Nomascus leucogenys [TaxId: 61853]} lteiehlvqsvcksyretcqlrledllrqrsnifsreevtgyqrksmwemwercahhlte aiqyvvefakrlsgfmelcqndqivllkagamevvlvrmcraynadnrtvffegkyggme lfralgcselissifdfshslsalhfsedeialytalvlinahrpglqekrkveqlqynl elafhhhlckthrqsilaklppagklaslcsqhverlqifqhlh
Timeline for d5x8xg_: