Lineage for d5x8xg_ (5x8x G:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2341330Fold a.123: Nuclear receptor ligand-binding domain [48507] (1 superfamily)
    multihelical; 3 layers or orthogonally packed helices
  4. 2341331Superfamily a.123.1: Nuclear receptor ligand-binding domain [48508] (2 families) (S)
  5. 2343011Family a.123.1.0: automated matches [191623] (1 protein)
    not a true family
  6. 2343012Protein automated matches [191142] (6 species)
    not a true protein
  7. 2343210Species Nomascus leucogenys [TaxId:61853] [335245] (17 PDB entries)
  8. 2343234Domain d5x8xg_: 5x8x G: [335259]
    automated match to d3l0la_
    complexed with 82o; mutant

Details for d5x8xg_

PDB Entry: 5x8x (more details), 2.6 Å

PDB Description: crystal structure of the mutant human ror gamma ligand binding domain with compound a.
PDB Compounds: (G:) Uncharacterized protein

SCOPe Domain Sequences for d5x8xg_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5x8xg_ a.123.1.0 (G:) automated matches {Nomascus leucogenys [TaxId: 61853]}
lteiehlvqsvcksyretcqlrledllrqrsnifsreevtgyqrksmwemwercahhlte
aiqyvvefakrlsgfmelcqndqivllkagamevvlvrmcraynadnrtvffegkyggme
lfralgcselissifdfshslsalhfsedeialytalvlinahrpglqekrkveqlqynl
elafhhhlckthrqsilaklppagklaslcsqhverlqifqhlh

SCOPe Domain Coordinates for d5x8xg_:

Click to download the PDB-style file with coordinates for d5x8xg_.
(The format of our PDB-style files is described here.)

Timeline for d5x8xg_: