Lineage for d5kb5a_ (5kb5 A:)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2511779Fold c.72: Ribokinase-like [53612] (3 superfamilies)
    core: 3 layers: a/b/a; mixed beta-sheet of 8 strands, order 21345678, strand 7 is antiparallel to the rest
    potential superfamily: members of this fold have similar functions but different ATP-binding sites
  4. 2511780Superfamily c.72.1: Ribokinase-like [53613] (6 families) (S)
    has extra strand located between strands 2 and 3
  5. 2511781Family c.72.1.1: Ribokinase-like [53614] (10 proteins)
    automatically mapped to Pfam PF00294
  6. 2511803Protein Adenosine kinase [53617] (3 species)
  7. 2511814Species Mouse (Mus musculus) [TaxId:10090] [335051] (2 PDB entries)
  8. 2511817Domain d5kb5a_: 5kb5 A: [335256]
    automated match to d4o1lb_
    complexed with adn, adp, cl, k, mg, pg4, po4

Details for d5kb5a_

PDB Entry: 5kb5 (more details), 1.8 Å

PDB Description: crystal structure of the adenosine kinase from mus musculus in complex with adenosine and adenosine-diphosphate
PDB Compounds: (A:) adenosine kinase

SCOPe Domain Sequences for d5kb5a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5kb5a_ c.72.1.1 (A:) Adenosine kinase {Mouse (Mus musculus) [TaxId: 10090]}
lsenvlfgmgnplldisavvdkdfldkyslkpndqilaedkhkelfdelvkkfkveyhag
gstqnsmkvaqwliqephkaatffgcigidkfgeilkrkaadahvdahyyeqneqptgtc
aacitggnrslvanlaaancykkekhldlernwvlvekarvyyiagffltvspesvlkva
ryaaennrvftlnlsapfisqffkealmdvmpyvdilfgneteaatfareqgfetkdike
iakkaqalpkvnskrqrtviftqgrddtivaaendvtafpvldqnqeeiidtngagdafv
ggflsqlvsdkplteciraghyaasviirrtgctfpekpdf

SCOPe Domain Coordinates for d5kb5a_:

Click to download the PDB-style file with coordinates for d5kb5a_.
(The format of our PDB-style files is described here.)

Timeline for d5kb5a_: