Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.72: Ribokinase-like [53612] (3 superfamilies) core: 3 layers: a/b/a; mixed beta-sheet of 8 strands, order 21345678, strand 7 is antiparallel to the rest potential superfamily: members of this fold have similar functions but different ATP-binding sites |
Superfamily c.72.1: Ribokinase-like [53613] (6 families) has extra strand located between strands 2 and 3 |
Family c.72.1.1: Ribokinase-like [53614] (10 proteins) automatically mapped to Pfam PF00294 |
Protein Adenosine kinase [53617] (3 species) |
Species Mouse (Mus musculus) [TaxId:10090] [335051] (2 PDB entries) |
Domain d5kb5a_: 5kb5 A: [335256] automated match to d4o1lb_ complexed with adn, adp, cl, k, mg, pg4, po4 |
PDB Entry: 5kb5 (more details), 1.8 Å
SCOPe Domain Sequences for d5kb5a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5kb5a_ c.72.1.1 (A:) Adenosine kinase {Mouse (Mus musculus) [TaxId: 10090]} lsenvlfgmgnplldisavvdkdfldkyslkpndqilaedkhkelfdelvkkfkveyhag gstqnsmkvaqwliqephkaatffgcigidkfgeilkrkaadahvdahyyeqneqptgtc aacitggnrslvanlaaancykkekhldlernwvlvekarvyyiagffltvspesvlkva ryaaennrvftlnlsapfisqffkealmdvmpyvdilfgneteaatfareqgfetkdike iakkaqalpkvnskrqrtviftqgrddtivaaendvtafpvldqnqeeiidtngagdafv ggflsqlvsdkplteciraghyaasviirrtgctfpekpdf
Timeline for d5kb5a_: