Lineage for d5kbxa_ (5kbx A:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2699446Fold a.24: Four-helical up-and-down bundle [47161] (29 superfamilies)
    core: 4 helices; bundle, closed or partly opened, left-handed twist; up-and-down
  4. 2700189Superfamily a.24.10: Histidine-containing phosphotransfer domain, HPT domain [47226] (7 families) (S)
    contains additional, fifth helix at the N-terminus
  5. 2700197Family a.24.10.2: Phosphorelay protein-like [47230] (3 proteins)
  6. 2700210Protein Phosphorelay protein ypd1 [47231] (2 species)
  7. 2700228Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:559292] [335252] (2 PDB entries)
  8. 2700230Domain d5kbxa_: 5kbx A: [335253]
    Other proteins in same PDB: d5kbxb_
    automated match to d2r25a_
    complexed with gol, po4

Details for d5kbxa_

PDB Entry: 5kbx (more details), 2.8 Å

PDB Description: co-crystal structure of the saccharomyces cerevisiae histidine phosphotransfer signaling protein ypd1 and the receiver domain of its downstream response regulator ssk1
PDB Compounds: (A:) Phosphorelay intermediate protein YPD1

SCOPe Domain Sequences for d5kbxa_:

Sequence, based on SEQRES records: (download)

>d5kbxa_ a.24.10.2 (A:) Phosphorelay protein ypd1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]}
tipseiinwtilneiismddddsdfskgliiqfidqaqttfaqmqrqldgeknlteldnl
ghflkgssaalglqriawvceriqnlgrkmehffpnktelvntlsdksiinginidedde
eikiqvddkdensiyliliakalnqsrlefklarielskyyntnl

Sequence, based on observed residues (ATOM records): (download)

>d5kbxa_ a.24.10.2 (A:) Phosphorelay protein ypd1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]}
tipseiinwtilneiismddddsdfskgliiqfidqaqttfaqmqrqldgeknlteldnl
ghflkgssaalglqriawvceriqnlgrkmehffpnktelvntlsdksiinginikdens
iyliliakalnqsrlefklarielskyyntnl

SCOPe Domain Coordinates for d5kbxa_:

Click to download the PDB-style file with coordinates for d5kbxa_.
(The format of our PDB-style files is described here.)

Timeline for d5kbxa_: