Lineage for d5nqqa2 (5nqq A:160-331)
- Root: SCOPe 2.07
Class d: Alpha and beta proteins (a+b) [53931] (388 folds) 
Fold d.162: LDH C-terminal domain-like [56326] (1 superfamily)
unusual fold, defines familySuperfamily d.162.1: LDH C-terminal domain-like [56327] (3 families) 
Family d.162.1.1: Lactate & malate dehydrogenases, C-terminal domain [56328] (5 proteins)
N-terminal domain is NAD-binding module (alpha/beta Rossmann-fold domain)
automatically mapped to Pfam PF02866Protein Lactate dehydrogenase [56339] (20 species) 
Species Rabbit (Oryctolagus cuniculus) [TaxId:9986] [346390] (2 PDB entries) 
Domain d5nqqa2: 5nqq A:160-331 [335242]
Other proteins in same PDB: d5nqqa1, d5nqqb1, d5nqqc1, d5nqqd1
automated match to d4i9ha2
complexed with nai, oaa, so4
Details for d5nqqa2
PDB Entry: 5nqq (more details), 1.87 Å
PDB Description: rabbit muscle l-lactate dehydrogenase in complex with nadh and oxaloacetate
PDB Compounds: (A:) L-lactate dehydrogenase A chainSCOPe Domain Sequences for d5nqqa2:
Sequence; same for both SEQRES and ATOM records: (download)
>d5nqqa2 d.162.1.1 (A:160-331) Lactate dehydrogenase {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]}
sgcnldsarfrylmgerlgvhalschgwilgehgdssvpvwsgmnvagvslktlhpelgt
dadkeqwkqvhkqvvdsayeviklkgytswaiglsvadlaesimknlrrvhpistmlkgl
ygikedvflsvpcvlgqngisdvvkvtltseeeahlkksadtlwgiqkelqf
SCOPe Domain Coordinates for d5nqqa2:
Click to download the PDB-style file with coordinates for d5nqqa2.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d5nqqa2:
View in 3D
