SCOPe 2.08: Domain d5vyvb2: 5vyv B:85-173

Lineage for d5vyvb2 (5vyv B:85-173)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
   core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down

4. Superfamily a.4.5: 'Winged helix' DNA-binding domain [46785] (86 families)
   contains a small beta-sheet (wing)

5. Family a.4.5.0: automated matches [191329] (1 protein)
   not a true family

6. Protein automated matches [190154] (92 species)
   not a true protein

7. Species Escherichia coli [TaxId:83334] [335234] (1 PDB entry)

8. Domain d5vyvb2: 5vyv B:85-173 [335238]
   automated match to d3bz6a2
   complexed with peg

Details for d5vyvb2

PDB Entry: 5vyv, 2.48 Å

PDB Description: crystal structure of a protein of unknown function yceh/eck1052 involved in membrane biogenesis from escherichia coli

PDB Compounds: (B:) UPF0502 protein YceH

SCOPe Domain Sequences for d5vyvb2:

Sequence; same for both SEQRES and ATOM records:

>d5vyvb2 a.4.5.0 (B:85-173) automated matches {Escherichia coli [TaxId: 83334]}
fcnsefgdlklsaaevalittlllrgaqtpgelrsraarmyefsdmaeveltleqlanre
dgpfvvrlarepgkresrymhlfsgeved

Timeline for d5vyvb2:

• d5vyvb2 first appeared in SCOPe 2.06
  
• d5vyvb2 appears in SCOPe 2.07