![]() | Class a: All alpha proteins [46456] (289 folds) |
![]() | Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies) core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down |
![]() | Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (86 families) ![]() contains a small beta-sheet (wing) |
![]() | Family a.4.5.0: automated matches [191329] (1 protein) not a true family |
![]() | Protein automated matches [190154] (87 species) not a true protein |
![]() | Species Escherichia coli [TaxId:83334] [335234] (1 PDB entry) |
![]() | Domain d5vyva1: 5vyv A:1-84 [335235] automated match to d3bz6a1 complexed with peg |
PDB Entry: 5vyv (more details), 2.48 Å
SCOPe Domain Sequences for d5vyva1:
Sequence; same for both SEQRES and ATOM records: (download)
>d5vyva1 a.4.5.0 (A:1-84) automated matches {Escherichia coli [TaxId: 83334]} mkyqltalearvigcllekqvttpeqyplsvngvvtacnqktnrepvmnlsesevqeqld nlvkrhylrtvsgfgnrvtkyeqr
Timeline for d5vyva1: