Class g: Small proteins [56992] (94 folds) |
Fold g.35: HIPIP (high potential iron protein) [57651] (1 superfamily) folds around 4Fe-4S cluster |
Superfamily g.35.1: HIPIP (high potential iron protein) [57652] (1 family) |
Family g.35.1.1: HIPIP (high potential iron protein) [57653] (1 protein) |
Protein HIPIP (high potential iron protein) [57654] (9 species) |
Species Thermochromatium tepidum [TaxId:1050] [57660] (8 PDB entries) |
Domain d5wqqa_: 5wqq A: [335230] automated match to d1iuaa_ complexed with gol, sf4, so4 |
PDB Entry: 5wqq (more details), 0.8 Å
SCOPe Domain Sequences for d5wqqa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5wqqa_ g.35.1.1 (A:) HIPIP (high potential iron protein) {Thermochromatium tepidum [TaxId: 1050]} aapanavtaddptaialkynqdatkservaaarpglppeeqhcancqfmqanvgegdwkg cqlfpgklinvngwcaswtlkag
Timeline for d5wqqa_: