SCOPe 2.08: Domain d1gldg2: 1gld G:254-499

Lineage for d1gldg2 (1gld G:254-499)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
   3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest

4. Superfamily c.55.1: Actin-like ATPase domain [53067] (16 families)
   duplication contains two domains of this fold

5. Family c.55.1.4: Glycerol kinase [53089] (1 protein)

6. Protein Glycerol kinase [53090] (2 species)

7. Species Escherichia coli [TaxId:562] [53091] (14 PDB entries)

8. Domain d1gldg2: 1gld G:254-499 [33522]
   Other proteins in same PDB: d1gldf_
   complexed with adp, g3h, mn

Details for d1gldg2

PDB Entry: 1gld, 2.93 Å

PDB Description: cation promoted association (cpa) of a regulatory and target protein is controlled by phosphorylation

PDB Compounds: (G:) glycerol kinase

SCOPe Domain Sequences for d1gldg2:

Sequence; same for both SEQRES and ATOM records:

>d1gldg2 c.55.1.4 (G:254-499) Glycerol kinase {Escherichia coli [TaxId: 562]}
lcvkegmakntygtgcfmlmntgekavksengllttiacgptgevnyalegavfmagasi
qwlrdemklindaydseyfatkvqntngvyvvpaftglgapywdpyargaifgltrgvna
nhiiratlesiayqtrdvleamqadsgirlhalrvdggavannflmqfqsdilgtrverp
evrevtalgaaylaglavgfwqnldelqekavierefrpgietternyryagwkkavkra
maweeh

Timeline for d1gldg2:

• d1gldg2 first appeared (with stable ids) in SCOP 1.55
  
• d1gldg2 appears in SCOPe 2.07