Lineage for d5ulfc1 (5ulf C:1-147)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2183821Fold d.20: UBC-like [54494] (1 superfamily)
    alpha-beta(4)-alpha(3); core: meander beta-sheet plus one helix 2
  4. 2183822Superfamily d.20.1: UBC-like [54495] (5 families) (S)
  5. 2183823Family d.20.1.1: UBC-related [54496] (7 proteins)
  6. 2184040Protein automated matches [190124] (12 species)
    not a true protein
  7. 2184055Species Human (Homo sapiens) [TaxId:9606] [186848] (46 PDB entries)
  8. 2184080Domain d5ulfc1: 5ulf C:1-147 [335216]
    Other proteins in same PDB: d5ulfa2, d5ulfb_, d5ulfc2, d5ulfd_
    automated match to d2clwa_
    complexed with gol

Details for d5ulfc1

PDB Entry: 5ulf (more details), 1.8 Å

PDB Description: crystal structure of a ubch5b~ub conjugate
PDB Compounds: (C:) ubiquitin-conjugating enzyme e2 d2

SCOPe Domain Sequences for d5ulfc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5ulfc1 d.20.1.1 (C:1-147) automated matches {Human (Homo sapiens) [TaxId: 9606]}
malkrihkelndlardppaqsragpvgddmfhwqatimgpndspyqggvffltihfptdy
pfkppkvafttriyhpninsngsikldilrsqwspaltiskvllsissllsdpnpddplv
peiariyktdrekynriarewtqkyam

SCOPe Domain Coordinates for d5ulfc1:

Click to download the PDB-style file with coordinates for d5ulfc1.
(The format of our PDB-style files is described here.)

Timeline for d5ulfc1: