Lineage for d1gldg1 (1gld G:4-253)

  1. Root: SCOP 1.73
  2. 681097Class c: Alpha and beta proteins (a/b) [51349] (141 folds)
  3. 701284Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest
  4. 701285Superfamily c.55.1: Actin-like ATPase domain [53067] (13 families) (S)
    duplication contains two domains of this fold
  5. 701631Family c.55.1.4: Glycerol kinase [53089] (1 protein)
  6. 701632Protein Glycerol kinase [53090] (2 species)
  7. 701642Species Escherichia coli [TaxId:562] [53091] (13 PDB entries)
  8. 701665Domain d1gldg1: 1gld G:4-253 [33521]
    Other proteins in same PDB: d1gldf_

Details for d1gldg1

PDB Entry: 1gld (more details), 2.93 Å

PDB Description: cation promoted association (cpa) of a regulatory and target protein is controlled by phosphorylation
PDB Compounds: (G:) glycerol kinase

SCOP Domain Sequences for d1gldg1:

Sequence, based on SEQRES records: (download)

>d1gldg1 c.55.1.4 (G:4-253) Glycerol kinase {Escherichia coli [TaxId: 562]}
kyivaldqgttssravvmdhdaniisvsqrefeqiypkpgwvehdpmeiwatqsstlvev
lakadissdqiaaigitnqrettivweketgkpiynaivwqcrrtaeicehlkrdgledy
irsntglvidpyfsgtkvkwildhvegsrerarrgellfgtvdtwliwkmtqgrvhvtdy
tnasrtmlfnihtldwddkmlevldipremlpevrrssevygqtniggkggtripisgia
gdqqaalfgq

Sequence, based on observed residues (ATOM records): (download)

>d1gldg1 c.55.1.4 (G:4-253) Glycerol kinase {Escherichia coli [TaxId: 562]}
kyivaldqgttssravvmdhdaniisvsqrefeqiypkpgwvehdpmeiwatqsstlvev
lakadissdqiaaigitnqrettivweketgkpiynaivwqcrrtaeicehlkrdgledy
irsntglvidpyfsgtkvkwildhvegsrerarrgellfgtvdtwliwkmtqgrvhvtdy
tnasrtmlfnihtldwddkmlevldipremlpevrrssevygqtniipisgiagdqqaal
fgq

SCOP Domain Coordinates for d1gldg1:

Click to download the PDB-style file with coordinates for d1gldg1.
(The format of our PDB-style files is described here.)

Timeline for d1gldg1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1gldg2
View in 3D
Domains from other chains:
(mouse over for more information)
d1gldf_