SCOPe 2.06: Domain d5ulfa1: 5ulf A:1-147

Lineage for d5ulfa1 (5ulf A:1-147)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.20: UBC-like [54494] (1 superfamily)
   alpha-beta(4)-alpha(3); core: meander beta-sheet plus one helix 2

4. Superfamily d.20.1: UBC-like [54495] (5 families)

5. Family d.20.1.1: UBC-related [54496] (7 proteins)

6. Protein automated matches [190124] (12 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [186848] (46 PDB entries)

8. Domain d5ulfa1: 5ulf A:1-147 [335198]
   Other proteins in same PDB: d5ulfa2, d5ulfb_, d5ulfc2, d5ulfd_
   automated match to d2clwa_
   complexed with gol

Details for d5ulfa1

PDB Entry: 5ulf, 1.8 Å

PDB Description: crystal structure of a ubch5b~ub conjugate

PDB Compounds: (A:) ubiquitin-conjugating enzyme e2 d2

SCOPe Domain Sequences for d5ulfa1:

Sequence; same for both SEQRES and ATOM records:

>d5ulfa1 d.20.1.1 (A:1-147) automated matches {Human (Homo sapiens) [TaxId: 9606]}
malkrihkelndlardppaqsragpvgddmfhwqatimgpndspyqggvffltihfptdy
pfkppkvafttriyhpninsngsikldilrsqwspaltiskvllsissllsdpnpddplv
peiariyktdrekynriarewtqkyam

Timeline for d5ulfa1:

• d5ulfa1 is new in SCOPe 2.06-stable
  
• d5ulfa1 appears in SCOPe 2.07
  
• d5ulfa1 appears in the current release, SCOPe 2.08