Lineage for d5gjka_ (5gjk A:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 1981563Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 1981564Superfamily a.4.1: Homeodomain-like [46689] (20 families) (S)
    consists only of helices
  5. 1982467Family a.4.1.0: automated matches [191447] (1 protein)
    not a true family
  6. 1982468Protein automated matches [190674] (22 species)
    not a true protein
  7. 1982516Species Human (Homo sapiens) [TaxId:9606] [189258] (25 PDB entries)
  8. 1982520Domain d5gjka_: 5gjk A: [335197]
    automated match to d2fq3a1
    complexed with gol, po4

Details for d5gjka_

PDB Entry: 5gjk (more details), 2.05 Å

PDB Description: crystal structure of baf47 and baf155 complex
PDB Compounds: (A:) SWI/SNF complex subunit SMARCC1

SCOPe Domain Sequences for d5gjka_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5gjka_ a.4.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
nhiiipsyaswfdyncihvierralpeffngknksktpeiylayrnfmidtyrlnpqeyl
tstacrrnltgdvcavmrvhafleqwglvnyqvd

SCOPe Domain Coordinates for d5gjka_:

Click to download the PDB-style file with coordinates for d5gjka_.
(The format of our PDB-style files is described here.)

Timeline for d5gjka_: