SCOPe 2.08: Domain d5tuwc2: 5tuw C:174-311

Lineage for d5tuwc2 (5tuw C:174-311)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.17: Cystatin-like [54402] (7 superfamilies)
   Core: alpha-beta(4); helix packs against coiled antiparallel beta-sheet

4. Superfamily d.17.4: NTF2-like [54427] (31 families)
   has a beta-alpha(2)-beta insertion after the main helix

5. Family d.17.4.0: automated matches [191337] (1 protein)
   not a true family

6. Protein automated matches [190205] (35 species)
   not a true protein

7. Species Synechocystis sp. [TaxId:1111708] [275032] (5 PDB entries)

8. Domain d5tuwc2: 5tuw C:174-311 [335174]
   Other proteins in same PDB: d5tuwa1, d5tuwb1, d5tuwc1, d5tuwd1, d5tuwe1, d5tuwf1
   automated match to d1m98a2
   complexed with eq3, gol

Details for d5tuwc2

PDB Entry: 5tuw, 2.3 Å

PDB Description: crystal structure of orange carotenoid protein with partial loss of 3'oh echinenone chromophore

PDB Compounds: (C:) Orange carotenoid-binding protein

SCOPe Domain Sequences for d5tuwc2:

Sequence; same for both SEQRES and ATOM records:

>d5tuwc2 d.17.4.0 (C:174-311) automated matches {Synechocystis sp. [TaxId: 1111708]}
epvvppqdtasrtkvsiegvtnatvlnymdnlnandfdtlielftsdgalqppfqrpivg
kenvlrffreecqnlklipergvtepaedgftqikvtgkvqtpwfggnvgmniawrflln
pegkiffvaidllaspke

Timeline for d5tuwc2:

• d5tuwc2 first appeared in SCOPe 2.06
  
• d5tuwc2 appears in SCOPe 2.07