Lineage for d5tuwc2 (5tuw C:174-311)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2935697Fold d.17: Cystatin-like [54402] (7 superfamilies)
    Core: alpha-beta(4); helix packs against coiled antiparallel beta-sheet
  4. 2936287Superfamily d.17.4: NTF2-like [54427] (31 families) (S)
    has a beta-alpha(2)-beta insertion after the main helix
  5. 2937177Family d.17.4.0: automated matches [191337] (1 protein)
    not a true family
  6. 2937178Protein automated matches [190205] (35 species)
    not a true protein
  7. 2937358Species Synechocystis sp. [TaxId:1111708] [275032] (5 PDB entries)
  8. 2937365Domain d5tuwc2: 5tuw C:174-311 [335174]
    Other proteins in same PDB: d5tuwa1, d5tuwb1, d5tuwc1, d5tuwd1, d5tuwe1, d5tuwf1
    automated match to d1m98a2
    complexed with eq3, gol

Details for d5tuwc2

PDB Entry: 5tuw (more details), 2.3 Å

PDB Description: crystal structure of orange carotenoid protein with partial loss of 3'oh echinenone chromophore
PDB Compounds: (C:) Orange carotenoid-binding protein

SCOPe Domain Sequences for d5tuwc2:

Sequence; same for both SEQRES and ATOM records: (download)

>d5tuwc2 d.17.4.0 (C:174-311) automated matches {Synechocystis sp. [TaxId: 1111708]}
epvvppqdtasrtkvsiegvtnatvlnymdnlnandfdtlielftsdgalqppfqrpivg
kenvlrffreecqnlklipergvtepaedgftqikvtgkvqtpwfggnvgmniawrflln
pegkiffvaidllaspke

SCOPe Domain Coordinates for d5tuwc2:

Click to download the PDB-style file with coordinates for d5tuwc2.
(The format of our PDB-style files is described here.)

Timeline for d5tuwc2: