SCOPe 2.08: Domain d5ut4a_: 5ut4 A:

Lineage for d5ut4a_ (5ut4 A:)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
   consists of two alpha+beta domains, C-terminal domain is mostly alpha helical

4. Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families)
   shares functional and structural similarities with the ATP-grasp fold and PIPK

5. Family d.144.1.0: automated matches [191359] (1 protein)
   not a true family

6. Protein automated matches [190417] (37 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187294] (1476 PDB entries)

8. Domain d5ut4a_: 5ut4 A: [335171]
   automated match to d1ir3a_
   complexed with dms, dqx, gol

Details for d5ut4a_

PDB Entry: 5ut4, 2 Å

PDB Description: jak2 jh2 in complex with nvp-bsk805

PDB Compounds: (A:) Tyrosine-protein kinase JAK2

SCOPe Domain Sequences for d5ut4a_:

Sequence; same for both SEQRES and ATOM records:

>d5ut4a_ d.144.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
fhkirnedlifneslgqgtftkifkgvrrevgdygqlhetevllkvldkahrnysesffe
aasmmsklshkhlvlnygvcvcgdenilvqefvkfgsldtylkknkncinilwklevakq
laaamhfleentlihgnvcaknillireedrktgnppfiklsdpgisitvlpkdilqeri
pwvppecienpknlnlatdkwsfgttlweicsggdkplsaldsqrklqfyedrhqlpapk
aaelanlinncmdyepdhrpsfraiirdlnslf

Timeline for d5ut4a_:

• d5ut4a_ first appeared in SCOPe 2.06
  
• d5ut4a_ appears in SCOPe 2.07