Lineage for d5nmlb1 (5nml B:2-118)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2021374Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2021375Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2021376Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 2023921Protein automated matches [190119] (22 species)
    not a true protein
  7. 2024425Species Llama (Lama glama) [TaxId:9844] [187485] (138 PDB entries)
  8. 2024657Domain d5nmlb1: 5nml B:2-118 [335164]
    Other proteins in same PDB: d5nmla2, d5nmlb2, d5nmlc2, d5nmld2, d5nmle2, d5nmlf2, d5nmlg2, d5nmlh2
    automated match to d3ogog_
    complexed with edo, hg

Details for d5nmlb1

PDB Entry: 5nml (more details), 2.5 Å

PDB Description: nb36 ser85cys with hg bound
PDB Compounds: (B:) Nanobody Nb36 Ser85Cys

SCOPe Domain Sequences for d5nmlb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5nmlb1 b.1.1.1 (B:2-118) automated matches {Llama (Lama glama) [TaxId: 9844]}
qvqlvesggglvqaggslrlscvvsgsavsdyamgwyrqapgkqrelvaaiynsgrtnyv
dsvkgrftiskdnakktvylqmnclkpedtadyfcnllgattmsnavwgqgtqvtvs

SCOPe Domain Coordinates for d5nmlb1:

Click to download the PDB-style file with coordinates for d5nmlb1.
(The format of our PDB-style files is described here.)

Timeline for d5nmlb1: