| Class g: Small proteins [56992] (100 folds) |
| Fold g.41: Rubredoxin-like [57769] (17 superfamilies) metal(zinc or iron)-bound fold; sequence contains two CX(n)C motifs, in most cases n = 2 |
Superfamily g.41.5: Rubredoxin-like [57802] (4 families) ![]() |
| Family g.41.5.1: Rubredoxin [57803] (5 proteins) |
| Protein Rubredoxin [57804] (8 species) |
| Species Pyrococcus furiosus [TaxId:2261] [57809] (30 PDB entries) Uniprot P24297 |
| Domain d5nw3a_: 5nw3 A: [335163] automated match to d1bq8a_ complexed with fe, k, na, po4 |
PDB Entry: 5nw3 (more details), 0.59 Å
SCOPe Domain Sequences for d5nw3a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5nw3a_ g.41.5.1 (A:) Rubredoxin {Pyrococcus furiosus [TaxId: 2261]}
makwvckicgyiydedagdpdngispgtkfeelpddwvcpicgapksefekled
Timeline for d5nw3a_: