SCOPe 2.08: Domain d5nmlg1: 5nml G:3-118

Lineage for d5nmlg1 (5nml G:3-118)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)

6. Protein automated matches [190119] (24 species)
   not a true protein

7. Species Llama (Lama glama) [TaxId:9844] [187485] (245 PDB entries)

8. Domain d5nmlg1: 5nml G:3-118 [335160]
   Other proteins in same PDB: d5nmla2, d5nmlb2, d5nmlc2, d5nmld2, d5nmle2, d5nmlf2, d5nmlg2, d5nmlh2, d5nmli2
   automated match to d3ogog_
   complexed with edo, hg

Details for d5nmlg1

PDB Entry: 5nml, 2.5 Å

PDB Description: nb36 ser85cys with hg bound

PDB Compounds: (G:) Nanobody Nb36 Ser85Cys

SCOPe Domain Sequences for d5nmlg1:

Sequence, based on SEQRES records:

>d5nmlg1 b.1.1.1 (G:3-118) automated matches {Llama (Lama glama) [TaxId: 9844]}
vqlvesggglvqaggslrlscvvsgsavsdyamgwyrqapgkqrelvaaiynsgrtnyvd
svkgrftiskdnakktvylqmnclkpedtadyfcnllgattmsnavwgqgtqvtvs

Sequence, based on observed residues (ATOM records):

>d5nmlg1 b.1.1.1 (G:3-118) automated matches {Llama (Lama glama) [TaxId: 9844]}
vqlvesggglvqaggslrlscvvsgsavsdyamgwyrqapgkqrelvaaiynsgrtnyvd
svkgrftiskdnakktvylqmnclkpedtadyfcnllgawgqgtqvtvs

Timeline for d5nmlg1:

• d5nmlg1 first appeared in SCOPe 2.06
  
• d5nmlg1 appears in SCOPe 2.07