Lineage for d5k1lb_ (5k1l B:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2685878Fold a.1: Globin-like [46457] (2 superfamilies)
    core: 6 helices; folded leaf, partly opened
  4. 2685879Superfamily a.1.1: Globin-like [46458] (5 families) (S)
  5. 2685963Family a.1.1.2: Globins [46463] (27 proteins)
    Heme-binding protein
  6. 2688401Protein automated matches [190359] (43 species)
    not a true protein
  7. 2688404Species Amphitrite ornata [TaxId:129555] [189339] (47 PDB entries)
  8. 2688408Domain d5k1lb_: 5k1l B: [335154]
    automated match to d4kn3a_
    complexed with bzi, hem, so4

Details for d5k1lb_

PDB Entry: 5k1l (more details), 1.08 Å

PDB Description: dehaloperoxidase b from amphitrite ornata: benzimidazole complex
PDB Compounds: (B:) Dehaloperoxidase B

SCOPe Domain Sequences for d5k1lb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5k1lb_ a.1.1.2 (B:) automated matches {Amphitrite ornata [TaxId: 129555]}
gfkqdiatlrgdlrtyaqdiflaflnkypdekrnfknyvgksdqelksmakfgdhtekvf
nlmmevadratdcvplasdastlvqmkqhsglttgnfeklfvalveymrasgqsfdsqsw
drfgknlvsalssagmk

SCOPe Domain Coordinates for d5k1lb_:

Click to download the PDB-style file with coordinates for d5k1lb_.
(The format of our PDB-style files is described here.)

Timeline for d5k1lb_: