SCOPe 2.06: Domain d5nmlh1: 5nml H:3-118

Lineage for d5nmlh1 (5nml H:3-118)

Root: SCOPe 2.06
Class b: All beta proteins [48724] (177 folds)
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
sandwich; 7 strands in 2 sheets; greek-key
some members of the fold have additional strands
Superfamily b.1.1: Immunoglobulin [48726] (5 families)
Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
Protein automated matches [190119] (22 species)
not a true protein
Species Llama (Lama glama) [TaxId:9844] [187485] (138 PDB entries)
Domain d5nmlh1: 5nml H:3-118 [335146]
Other proteins in same PDB: d5nmla2, d5nmlb2, d5nmlc2, d5nmld2, d5nmle2, d5nmlf2, d5nmlg2, d5nmlh2
automated match to d3ogog_
complexed with edo, hg

Details for d5nmlh1

PDB Entry: 5nml (more details), 2.5 Å

PDB Description: nb36 ser85cys with hg bound

PDB Compounds: (H:) Nanobody Nb36 Ser85Cys

SCOPe Domain Sequences for d5nmlh1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5nmlh1 b.1.1.1 (H:3-118) automated matches {Llama (Lama glama) [TaxId: 9844]}
vqlvesggglvqaggslrlscvvsgsavsdyamgwyrqapgkqrelvaaiynsgrtnyvd
svkgrftiskdnakktvylqmnclkpedtadyfcnllgattmsnavwgqgtqvtvs

SCOPe Domain Coordinates for d5nmlh1:

Click to download the PDB-style file with coordinates for d5nmlh1.
(The format of our PDB-style files is described here.)

Timeline for d5nmlh1: