Lineage for d1glfy1 (1glf Y:2-253)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2883383Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest
  4. 2883384Superfamily c.55.1: Actin-like ATPase domain [53067] (16 families) (S)
    duplication contains two domains of this fold
  5. 2884335Family c.55.1.4: Glycerol kinase [53089] (1 protein)
  6. 2884336Protein Glycerol kinase [53090] (2 species)
  7. 2884378Species Escherichia coli [TaxId:562] [53091] (14 PDB entries)
  8. 2884423Domain d1glfy1: 1glf Y:2-253 [33513]
    complexed with adp, gol, po4; mutant

Details for d1glfy1

PDB Entry: 1glf (more details), 2.62 Å

PDB Description: crystal structures of escherichia coli glycerol kinase and the mutant a65t in an inactive tetramer: conformational changes and implications for allosteric regulation
PDB Compounds: (Y:) protein (glycerol kinase)

SCOPe Domain Sequences for d1glfy1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1glfy1 c.55.1.4 (Y:2-253) Glycerol kinase {Escherichia coli [TaxId: 562]}
ekkyivaldqgttssravvmdhdaniisvsqrefeqiypkpgwvehdpmeiwatqsstlv
evlakadissdqiaaigitnqrettivweketgkpiynaivwqcrrtaeicehlkrdgle
dyirsntglvidpyfsgtkvkwildhvegsrerarrgellfgtvdtwliwkmtqgrvhvt
dytnasrtmlfnihtldwddkmlevldipremlpevrrssevygqtniggkggtripisg
iagdqqaalfgq

SCOPe Domain Coordinates for d1glfy1:

Click to download the PDB-style file with coordinates for d1glfy1.
(The format of our PDB-style files is described here.)

Timeline for d1glfy1: