SCOPe 2.06: Domain d5nm0c_: 5nm0 C:

Lineage for d5nm0c_ (5nm0 C:)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)

6. Protein automated matches [190119] (22 species)
   not a true protein

7. Species Llama (Lama glama) [TaxId:9844] [187485] (138 PDB entries)

8. Domain d5nm0c_: 5nm0 C: [335119]
   Other proteins in same PDB: d5nm0a2, d5nm0b2
   automated match to d3ogog_
   complexed with hg

Details for d5nm0c_

PDB Entry: 5nm0, 1.5 Å

PDB Description: nb36 ser85cys with hg, crystal form 1

PDB Compounds: (C:) Nb36

SCOPe Domain Sequences for d5nm0c_:

Sequence, based on SEQRES records:

>d5nm0c_ b.1.1.1 (C:) automated matches {Llama (Lama glama) [TaxId: 9844]}
vqlvesggglvqaggslrlscvvsgsavsdyamgwyrqapgkqrelvaaiynsgrtnyvd
svkgrftiskdnakktvylqmnclkpedtadyfcnllgattmsnavwgqgtqvtvs

Sequence, based on observed residues (ATOM records):

>d5nm0c_ b.1.1.1 (C:) automated matches {Llama (Lama glama) [TaxId: 9844]}
vqlvesggglvqaggslrlscvvsgsavsdyamgwyrqapgkqrelvaaiynsgrtnyvd
svkgrftiskdnakktvylqmnclkpedtadyfcnllgatvwgqgtqvtvs

Timeline for d5nm0c_:

• d5nm0c_ is new in SCOPe 2.06-stable
  
• d5nm0c_ is called d5nm0c1 in SCOPe 2.07
  
• d5nm0c_ appears in the current release, SCOPe 2.08, called d5nm0c1