Lineage for d5t7dd_ (5t7d D:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2574993Fold d.108: Acyl-CoA N-acyltransferases (Nat) [55728] (1 superfamily)
    3 layers: a/b/a; contains mixed beta-sheet
  4. 2574994Superfamily d.108.1: Acyl-CoA N-acyltransferases (Nat) [55729] (11 families) (S)
  5. 2575571Family d.108.1.0: automated matches [191308] (1 protein)
    not a true family
  6. 2575572Protein automated matches [190038] (48 species)
    not a true protein
  7. 2576037Species Streptomyces hygroscopicus [TaxId:1912] [335112] (2 PDB entries)
  8. 2576041Domain d5t7dd_: 5t7d D: [335113]
    automated match to d1yr0a1
    complexed with aco, act

Details for d5t7dd_

PDB Entry: 5t7d (more details), 1.4 Å

PDB Description: crystal structure of streptomyces hygroscopicus bialaphos resistance (bar) protein in complex with acetyl coenzyme a
PDB Compounds: (D:) Phosphinothricin N-acetyltransferase

SCOPe Domain Sequences for d5t7dd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5t7dd_ d.108.1.0 (D:) automated matches {Streptomyces hygroscopicus [TaxId: 1912]}
padirrateadmpavctivnhyietstvnfrtepqepqewtddlvrlrerypwlvaevdg
evagiayagpwkarnaydwtaestvyvsprhqrtglgstlythllksleaqgfksvvavi
glpndpsvrmhealgyaprgmlraagfkhgnwhdvgfwqldfslpvpprpvlpv

SCOPe Domain Coordinates for d5t7dd_:

Click to download the PDB-style file with coordinates for d5t7dd_.
(The format of our PDB-style files is described here.)

Timeline for d5t7dd_: