Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.48: TK C-terminal domain-like [52921] (1 superfamily) 3 layers: a/b/a; mixed beta-sheet of 5 strands, order 13245, strand 1 is antiparallel to the rest |
Superfamily c.48.1: TK C-terminal domain-like [52922] (4 families) |
Family c.48.1.0: automated matches [227237] (1 protein) not a true family |
Protein automated matches [226991] (9 species) not a true protein |
Species Chlamydomonas reinhardtii [TaxId:3055] [335088] (2 PDB entries) |
Domain d5nd5b3: 5nd5 B:580-717 [335099] Other proteins in same PDB: d5nd5a1, d5nd5a2, d5nd5b1, d5nd5b2 automated match to d1itza3 complexed with mg, tpp |
PDB Entry: 5nd5 (more details), 1.74 Å
SCOPe Domain Sequences for d5nd5b3:
Sequence; same for both SEQRES and ATOM records: (download)
>d5nd5b3 c.48.1.0 (B:580-717) automated matches {Chlamydomonas reinhardtii [TaxId: 3055]} pncsvegvakgaytihdtkagvkpdvilmgtgselelataaagilekegknvrvvsfpcw elfeeqsaeykesvlpsdvtarvsveaatsfgwakyiglkgkhvgidtfgasapaptlye kfgitvnhvveaakatlq
Timeline for d5nd5b3: