Lineage for d5nd5b3 (5nd5 B:580-717)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2135231Fold c.48: TK C-terminal domain-like [52921] (1 superfamily)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 13245, strand 1 is antiparallel to the rest
  4. 2135232Superfamily c.48.1: TK C-terminal domain-like [52922] (4 families) (S)
  5. 2135398Family c.48.1.0: automated matches [227237] (1 protein)
    not a true family
  6. 2135399Protein automated matches [226991] (9 species)
    not a true protein
  7. 2135420Species Chlamydomonas reinhardtii [TaxId:3055] [335088] (2 PDB entries)
  8. 2135424Domain d5nd5b3: 5nd5 B:580-717 [335099]
    Other proteins in same PDB: d5nd5a1, d5nd5a2, d5nd5b1, d5nd5b2
    automated match to d1itza3
    complexed with mg, tpp

Details for d5nd5b3

PDB Entry: 5nd5 (more details), 1.74 Å

PDB Description: crystal structure of transketolase from chlamydomonas reinhardtii in complex with tpp and mg2+
PDB Compounds: (B:) transketolase

SCOPe Domain Sequences for d5nd5b3:

Sequence; same for both SEQRES and ATOM records: (download)

>d5nd5b3 c.48.1.0 (B:580-717) automated matches {Chlamydomonas reinhardtii [TaxId: 3055]}
pncsvegvakgaytihdtkagvkpdvilmgtgselelataaagilekegknvrvvsfpcw
elfeeqsaeykesvlpsdvtarvsveaatsfgwakyiglkgkhvgidtfgasapaptlye
kfgitvnhvveaakatlq

SCOPe Domain Coordinates for d5nd5b3:

Click to download the PDB-style file with coordinates for d5nd5b3.
(The format of our PDB-style files is described here.)

Timeline for d5nd5b3: