Lineage for d5n8aa1 (5n8a A:1-120)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2058098Fold b.40: OB-fold [50198] (16 superfamilies)
    barrel, closed or partly opened n=5, S=10 or S=8; greek-key
  4. 2059387Superfamily b.40.4: Nucleic acid-binding proteins [50249] (17 families) (S)
  5. 2059459Family b.40.4.3: Single strand DNA-binding domain, SSB [50263] (13 proteins)
    barrel, closed; n=5, S=10
  6. 2059651Protein automated matches [190206] (9 species)
    not a true protein
  7. 2059664Species Human (Homo sapiens) [TaxId:9606] [186959] (26 PDB entries)
  8. 2059672Domain d5n8aa1: 5n8a A:1-120 [335082]
    Other proteins in same PDB: d5n8aa2
    automated match to d2b3ga_

Details for d5n8aa1

PDB Entry: 5n8a (more details), 1.28 Å

PDB Description: structure of rpa70n in complex with primpol (fragment 480-560)
PDB Compounds: (A:) Replication protein A 70 kDa DNA-binding subunit

SCOPe Domain Sequences for d5n8aa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5n8aa1 b.40.4.3 (A:1-120) automated matches {Human (Homo sapiens) [TaxId: 9606]}
mvgqlsrgaiaaimqkgdtnikpilqvinirpittgnsppryrllmsdglntlssfmlat
qlnplveeeqlssncvcqihrfivntlkdgrrvvilmelevlksaeavgvkignpvpyne

SCOPe Domain Coordinates for d5n8aa1:

Click to download the PDB-style file with coordinates for d5n8aa1.
(The format of our PDB-style files is described here.)

Timeline for d5n8aa1: