SCOPe 2.06: Domain d5jy5b1: 5jy5 B:2-104

Lineage for d5jy5b1 (5jy5 B:2-104)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
   core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest

4. Superfamily c.47.1: Thioredoxin-like [52833] (24 families)

5. Family c.47.1.0: automated matches [191312] (1 protein)
   not a true family

6. Protein automated matches [190056] (165 species)
   not a true protein

7. Species Cryptococcus neoformans [TaxId:235443] [335068] (1 PDB entry)

8. Domain d5jy5b1: 5jy5 B:2-104 [335070]
   Other proteins in same PDB: d5jy5a2, d5jy5b2
   automated match to d1syra_
   complexed with gol, so4, trs

Details for d5jy5b1

PDB Entry: 5jy5, 1.8 Å

PDB Description: crystal structure of thioredoxin 1 from cryptococcus neoformans at 1.8 angstroms resolution

PDB Compounds: (B:) thioredoxin

SCOPe Domain Sequences for d5jy5b1:

Sequence; same for both SEQRES and ATOM records:

>d5jy5b1 c.47.1.0 (B:2-104) automated matches {Cryptococcus neoformans [TaxId: 235443]}
vkaiesydewktltsgsdvvvvdywatwcgpckmisphfaklegkfpnvkfakvdveeqe
diakeaqikamptfvaykdgkvietvtgavpakinalldkvaa

Timeline for d5jy5b1:

• d5jy5b1 is new in SCOPe 2.06-stable
  
• d5jy5b1 appears in SCOPe 2.07
  
• d5jy5b1 appears in the current release, SCOPe 2.08