Lineage for d1glag1 (1gla G:4-253)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2122050Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest
  4. 2122051Superfamily c.55.1: Actin-like ATPase domain [53067] (16 families) (S)
    duplication contains two domains of this fold
  5. 2122736Family c.55.1.4: Glycerol kinase [53089] (1 protein)
  6. 2122737Protein Glycerol kinase [53090] (2 species)
  7. 2122779Species Escherichia coli [TaxId:562] [53091] (14 PDB entries)
  8. 2122816Domain d1glag1: 1gla G:4-253 [33507]
    Other proteins in same PDB: d1glaf_
    complexed with gol

Details for d1glag1

PDB Entry: 1gla (more details), 2.6 Å

PDB Description: structure of the regulatory complex of escherichia coli iiiglc with glycerol kinase
PDB Compounds: (G:) glycerol kinase

SCOPe Domain Sequences for d1glag1:

Sequence, based on SEQRES records: (download)

>d1glag1 c.55.1.4 (G:4-253) Glycerol kinase {Escherichia coli [TaxId: 562]}
kyivaldqgttssravvmdhdaniisvsqrefeqiypkpgwvehdpmeiwatqsstlvev
lakadissdqiaaigitnqrettivweketgkpiynaivwqcrrtaeicehlkrdgledy
irsntglvidpyfsgtkvkwildhvegsrerarrgellfgtvdtwliwkmtqgrvhvtdy
tnasrtmlfnihtldwddkmlevldipremlpevrrssevygqtniggkggtripisgia
gdqqaalfgq

Sequence, based on observed residues (ATOM records): (download)

>d1glag1 c.55.1.4 (G:4-253) Glycerol kinase {Escherichia coli [TaxId: 562]}
kyivaldqgttssravvmdhdaniisvsqrefeqiypkpgwvehdpmeiwatqsstlvev
lakadissdqiaaigitnqrettivweketgkpiynaivwqcrrtaeicehlkrdgledy
irsntglvidpyfsgtkvkwildhvegsrerarrgellfgtvdtwliwkmtqgrvhvtdy
tnasrtmlfnihtldwddkmlevldipremlpevrrssevygqtniipisgiagdqqaal
fgq

SCOPe Domain Coordinates for d1glag1:

Click to download the PDB-style file with coordinates for d1glag1.
(The format of our PDB-style files is described here.)

Timeline for d1glag1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1glag2
View in 3D
Domains from other chains:
(mouse over for more information)
d1glaf_